PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_23164_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 490aa    MW: 53940.6 Da    PI: 6.7526
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_23164_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-164592148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+WT+ Ed +l+++vk++G g+W+++ r  g+ R++k+c++rw ++l
  cra_locus_23164_iso_1_len_1568_ver_3 45 KGPWTAAEDGILIEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANHL 92
                                          79******************************************9986 PP

2Myb_DNA-binding48.42.2e-1598141146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           +g+++++E+ l+v+++++lG++ W++ a+ ++ gRt++++k++w++
  cra_locus_23164_iso_1_len_1568_ver_3  98 KGAFSADEEALIVQLHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 141
                                           799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-234095IPR009057Homeodomain-like
PROSITE profilePS5129416.8424092IPR017930Myb domain
SuperFamilySSF466895.86E-2942139IPR009057Homeodomain-like
SMARTSM007177.2E-134494IPR001005SANT/Myb domain
PfamPF002492.5E-144592IPR001005SANT/Myb domain
CDDcd001675.68E-114792No hitNo description
PROSITE profilePS5129425.15293147IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2496146IPR009057Homeodomain-like
SMARTSM007173.2E-1597145IPR001005SANT/Myb domain
PfamPF002493.3E-1498141IPR001005SANT/Myb domain
CDDcd001671.01E-10100143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
XKERGFELMA PDVVGGGVVA SKGKNGGTSS LSSSSSRRGH NNLKKGPWTA AEDGILIEYV  60
KKHGEGNWNA VQRNSGLMRC GKSCRLRWAN HLRPNLKKGA FSADEEALIV QLHAKLGNKW  120
ARMAAQLPGR TDNEIKNYWN TRLKRRQRAG LPIYPHDVNV KTSSSTAAAL IVSDPQPQPL  180
TLNPGYSTPL SLFDIFDTMK PIQQQQRKAT TTTTAASNII IPNQHFNRGL QSNYSLTTTL  240
LPSSSIQYNC MTTTTTPPVS GLSFEQNGVV SGTGGGSRGG MELPSIQSSS ITTDHYVDDA  300
DGHDQTANQG FSGGNSTGLL EDLIDESHQV LTRANEKSKV IGFPMEQPKI QENYLWDYKV  360
MEGLNFNQDN LVMQEKQNIQ QDSTYAYNSS SIIRAKTTNN NTSCEATNQV DDDFLSLLED  420
NVPLTNNVQM PDLYDHGSIH NEQLPSIAAT SEEATITKRN HHEQEPSNNS GHDFDIGSCY  480
WKNMPGIFQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29391461107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068UQU41e-106A0A068UQU4_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154